CDS

Accession Number TCMCG072C18149
gbkey CDS
Protein Id XP_021852951.1
Location join(156373..156525,156738..156869)
Gene LOC110792456
GeneID 110792456
Organism Spinacia oleracea

Protein

Length 94aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA396054
db_source XM_021997259.1
Definition coatomer subunit beta'-1-like [Spinacia oleracea]

EGGNOG-MAPPER Annotation

COG_category U
Description The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko04131        [VIEW IN KEGG]
ko04147        [VIEW IN KEGG]
KEGG_ko ko:K17302        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005794        [VIEW IN EMBL-EBI]
GO:0005798        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006886        [VIEW IN EMBL-EBI]
GO:0006888        [VIEW IN EMBL-EBI]
GO:0006890        [VIEW IN EMBL-EBI]
GO:0006891        [VIEW IN EMBL-EBI]
GO:0008104        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0012506        [VIEW IN EMBL-EBI]
GO:0015031        [VIEW IN EMBL-EBI]
GO:0015833        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016192        [VIEW IN EMBL-EBI]
GO:0030117        [VIEW IN EMBL-EBI]
GO:0030120        [VIEW IN EMBL-EBI]
GO:0030126        [VIEW IN EMBL-EBI]
GO:0030135        [VIEW IN EMBL-EBI]
GO:0030137        [VIEW IN EMBL-EBI]
GO:0030659        [VIEW IN EMBL-EBI]
GO:0030660        [VIEW IN EMBL-EBI]
GO:0030662        [VIEW IN EMBL-EBI]
GO:0030663        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031410        [VIEW IN EMBL-EBI]
GO:0031982        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033036        [VIEW IN EMBL-EBI]
GO:0034613        [VIEW IN EMBL-EBI]
GO:0042886        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044431        [VIEW IN EMBL-EBI]
GO:0044433        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0045184        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048193        [VIEW IN EMBL-EBI]
GO:0048475        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0070727        [VIEW IN EMBL-EBI]
GO:0071702        [VIEW IN EMBL-EBI]
GO:0071705        [VIEW IN EMBL-EBI]
GO:0097708        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098805        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGATTCTCATTGTTTTTCACTACATTGCAGTTTGAACAGACATGTTTATTTCATTAGTAACCGAATACCTGAGGCTGCTTTGATGGCACGTTCTTATCTTCCCAGCAAAGTTTCAGAAATTGTTGAATTATGGAGAAAGGATCTCAACGAGGTAAATCCAAAGGCTGCTGAATCGTTGGCAGATCCACAGGAGTATCCAAATTTGTTTGAGGACTGGAAAATTGCTCTAGCTGGTATCCTCCTCCCATACATATACTGTTCTTTTTTGAATGGTTTTAGGTGA
Protein:  
MDSHCFSLHCSLNRHVYFISNRIPEAALMARSYLPSKVSEIVELWRKDLNEVNPKAAESLADPQEYPNLFEDWKIALAGILLPYIYCSFLNGFR